Catalog Peptides

Biopeptek is proud to offer a comprehensive list of catalog peptides, which exceed industry standards in terms of quality and cost. Please click here to request a quote or more information.

Please provide catalog peptides number and quantity (mg).

Number Peptide Product
P100001 Parathyroid Hormone (PTH) (1-34), Human
Sequence: SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF
P100002 a-Factor Mating Pheromone, yeast
Sequence: WHWLQLKPGQPMY
P100003 Parathyroid Hormone (PTH) (1-34), Human
Sequence: SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF
P100003-1 �-Amyloid (1-28)
P100003-2 �-Amyloid (25-35)
P100003-3 �-Amyloid (1-33)
P100003-4 �-Amyloid (11-22)
P100003-5 �-Amyloid (1-40)
P100003-6 �-Amyloid (1-42)
P100003-7 �-Amyloid (42-1)
P100007 Melanotan (MT)-II
Custom Peptide Sequence: Ac-{NLE}{ASP}{HIS}{D-PHE}{ARG}{TRP}{LYS}-NH2
P100008 Oxytocin
Sequence: CYIQNCPLG-NH2 (Disulfide bridge: 1-6)
P100009 DYKDDDDK tag
Sequence: H - Asp - Tyr - Lys - Asp - Asp - Asp - Asp - Lys - OH
P1000010 Cosmetic peptide
P1000010-1 GHK-Cu Sequence: Gly-His-Lys(Cu2+)
P1000010-2 PAL-GHK Sequence: pal-GHK
P1000010-3 Palmitoyl Hexapeptide Sequence: pal-VGVAPG (Pal-Val-Gly-Val-Ala-Pro-Gly)
P1000010-4 Acetyl Hexapeptide-3 Sequence: Ac-EEMQRR-NH2
P1000010-5 Palmitoyl Tetrapeptide-3 Sequence: pal-GQPR
P1000010-6 Palmitoyl Pentapeptide Sequence: pal-KTTKS
P1000011 AYPGKF-NH2, PAR4-AP
Sequence: Ala-Tyr-Pro-Gly-Lys-Phe-NH2
To request a quote for a catalog peptide, please click here. For more information, please contact us at info@biopeptek.com or call (610) 643-4881/(800) 352-6169. We are looking forward to helping you with your project.